EXD3 Rabbit Polyclonal Antibody

SKU TA344260

Rabbit Polyclonal Anti-FLJ20433 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLJ20433 antibody: synthetic peptide directed towards the N terminal of human FLJ20433. Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: exonuclease 3'-5' domain containing 3
• Database Link:
  NP_060290
  Q8N9H8
• Background: The specific function of FLJ20433 is not yet known.
• Synonyms: mut-7
• Note: Immunogen Sequence Homology: Human: 100%; Goat: 92%

Reference Data