OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RASGRP2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA344188
Rabbit Polyclonal Anti-RASGRP2 Antibody - N-terminal region
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY406966 Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP312719 Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4, 20 µg
20 ug
$737.00

View other "RASGRP2 or NM_153819" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RASGRP2 antibody: synthetic peptide directed towards the N terminal of human RASGRP2. Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 69 kDa
Gene Name RAS guanyl releasing protein 2
Database Link
Background The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act
Synonyms CALDAG-GEFI; CDC25L
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data
Protein Categories Cardiovascular diseases, Growth Factors, Intracellular Proteins
Protein Pathways Chemokine signaling pathway, MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products