TPPP3 Rabbit Polyclonal Antibody

SKU TA344122

Rabbit Polyclonal Anti-TPPP3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TPPP3 antibody: synthetic peptide directed towards the middle region of human TPPP3. Synthetic peptide located within the following region: PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: tubulin polymerization promoting protein family member 3
• Database Link:
  NP_057224
  Q9BW30
• Background: TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.
• Synonyms: CGI-38; p20; p25gamma; TPPP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data