MTHFSD Rabbit Polyclonal Antibody

SKU TA343917

Rabbit Polyclonal Anti-MTHFSD Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTHFSD antibody: synthetic peptide directed towards the N terminal of human MTHFSD. Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: methenyltetrahydrofolate synthetase domain containing
• Database Link:
  NP_073601
  Q2M296
• Background: The function remains unknows.
• Synonyms: FLJ12998; FLJ13893; MGC138262; MGC138264; MGC177233
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Rabbit: 92%; Guinea pig: 90%; Zebrafish: 77%

Reference Data