OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPSF73 (CPSF3) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA343845
Rabbit Polyclonal Anti-CPSF3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414121 Transient overexpression lysate of cleavage and polyadenylation specific factor 3, 73kDa (CPSF3) (as WB positive control) 100 ug
$436.00
TP305834 Recombinant protein of human cleavage and polyadenylation specific factor 3, 73kDa (CPSF3), 20 µg
20 ug
$737.00

View other "CPSF73 or NM_016207" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CPSF3 antibody: synthetic peptide directed towards the C terminal of human CPSF3. Synthetic peptide located within the following region: DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 75 kDa
Gene Name cleavage and polyadenylation specific factor 3
Database Link
Background CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.
Synonyms CPSF-73; CPSF73
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products