CBX6 Rabbit Polyclonal Antibody

SKU TA343728

Rabbit Polyclonal Anti-CBX6 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBX6 antibody: synthetic peptide directed towards the N terminal of human CBX6. Synthetic peptide located within the following region: FAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: chromobox 6
• Database Link:
  NP_055107
  O95503
• Background: CBX6 is involved in maintaining the transcriptionally repressive state of genes. It modifies chromatin, rendering it heritably changed in its expressibility.
• Synonyms: chromobox homolog 6; OTTHUMP00000028667
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors