Hoxd9 Rabbit Polyclonal Antibody

CAT#: TA343721

Rabbit Polyclonal Anti-Hoxd9 Antibody

Product Images

WB Suggested Anti-Hoxd9 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Hoxd9 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd9. Synthetic peptide located within the following region: MSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGTQGRPAGVADGPAAAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: homeo box D9
• Database Link:
  NP_001166940
  Entrez Gene 688999 Rat
  UniProt ID B5DFK3
• Background: Hoxd9 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Synonyms: Hox-4.3; Hox-4C; Hox-5.2; HOX4; HOX4C
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 86%