ZNF16 Rabbit Polyclonal Antibody

CAT#: TA343647

Rabbit Polyclonal Anti-ZNF16 Antibody

 Product Datasheet for 'TA343647'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB, IHC
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the N terminal of human ZNF16. Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 76kDa
Gene Name zinc finger protein 16
Background ZNF16 contains a C2H2 type of zinc finger, and thus may function as a transcription factor.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified.
Synonyms HZF1|KOX9
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 80%
Reference Data
Protein Families Transcription Factors
Other products for "ZNF16"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 16 (ZNF16), transcript variant 1
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones