ZNF16 Rabbit Polyclonal Antibody

CAT#: TA343647

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF16 Antibody


Product Datasheet for 'TA343647'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the N terminal of human ZNF16. Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 76 kDa
Gene Name zinc finger protein 16
Background ZNF16 contains a C2H2 type of zinc finger, and thus may function as a transcription factor.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified.
Synonyms HZF1; KOX9
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 80%
Reference Data
Protein Families Transcription Factors
Other products for "ZNF16"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 16 (ZNF16), transcript variant 1
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies