TCF15 Rabbit Polyclonal Antibody

CAT#: TA343480

Rabbit Polyclonal Anti-TCF15 Antibody

Product Images

WB Suggested Anti-TCF15 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCF15 antibody: synthetic peptide directed towards the N terminal of human TCF15. Synthetic peptide located within the following region: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: transcription factor 15 (basic helix-loop-helix)
• Database Link:
  NP_004600
  Entrez Gene 6939 Human
  UniProt ID Q12870
• Background: TCF15 is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding.The protein encoded by this gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding.
• Synonyms: bHLHa40; EC2; PARAXIS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors