IRF7 Rabbit Polyclonal Antibody

SKU TA343438

Rabbit Polyclonal Anti-IRF7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IRF7 antibody: synthetic peptide directed towards the N terminal of human IRF7. Synthetic peptide located within the following region: ISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 18 kDa
• Gene Name: interferon regulatory factor 7
• Database Link:
  NP_004022
  Q92985
• Background: IRF7 is interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue.IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established.
• Synonyms: IMD39; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Horse: 79%; Mouse: 79%; Zebrafish: 75%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway