ZNF177 Rabbit Polyclonal Antibody

SKU TA343404

Rabbit Polyclonal Anti-ZNF177 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF177 antibody: synthetic peptide directed towards the middle region of human ZNF177. Synthetic peptide located within the following region: AFRNSSCLRVHVRTHTGEKPYKCFQCEKAFSTSTNLIMHKRIHNGQKLHE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: zinc finger protein 177
• Database Link:
  NP_003442
  Q13360
• Background: ZNF177 contains 1 KRAB domain and 7 C2H2-type zinc fingers. ZNF177 belongs to the krueppel C2H2-type zinc-finger protein family. And it may be involved in transcriptional regulation.
• Synonyms: PIGX
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Mouse: 83%; Rat: 82%

Reference Data

• Protein Families: Transcription Factors