ZNF76 Rabbit Polyclonal Antibody

SKU TA343392

Rabbit Polyclonal Anti-ZNF76 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the N terminal of human ZNF76. Synthetic peptide located within the following region: LSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: zinc finger protein 76
• Database Link:
  NP_003418
  P36508
• Background: ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF76 is a general transcription repressor targeting TATA-binding protein (TBP), through a process regulated by sumoylation. ZNF76 interacts with TBP through both its N and C termini, and both regions are required for ZNF76 to exert its inhibitory function on p53-mediated transactivation. As a TBP-interacting transcriptional modulator, ZNF76 is also regulated by alternative splicing.
• Synonyms: D6S229E; Zfp523; ZNF523
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors