OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD1E Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA343311
Rabbit Polyclonal Anti-CD1E Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY420991 Transient overexpression lysate of CD1e molecule (CD1E), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP331127 Recombinant protein of human CD1e molecule (CD1E), transcript variant 8, 20 µg
20 ug
$867.00

View other "CD1E or NM_030893" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CD1E antibody is: synthetic peptide directed towards the C-terminal region of Human CD1E. Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name CD1e molecule
Database Link
Background This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined.
Synonyms CD1A; R2
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 86%; Horse: 86%; Rat: 79%; Mouse: 79%; Sheep: 79%; Guinea pig: 79%
Reference Data
Protein Categories CD Markers, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Porcine cluster of differentiation (CD) markers 2018 update
Dawson, Lunney
Res Vet Sci (2018) 118, 199-246 DOI: 10.1016/j.rvsc.2018.02.007
Cited by 58
AI Summary: In the paper "Porcine cluster of differentiation (CD) markers 2018 update," OriGene products such as cDNA clones and antibodies were referenced as key reagents for identifying and characterizing porcine CD markers, thereby supporting advances in pig immunology research.
Porcine cluster of differentiation (CD) markers 2018 update
Dawson, Lunney
Research in Veterinary Science (2018)
AI Summary: In the paper "Porcine cluster of differentiation (CD) markers 2018 update," the OriGene product pAb (WB) #TA343311 was used for the detection of CD2, contributing to the characterization of porcine CD markers.
Snippet: Skip to main content;pAb (WB) OriGene # TA343311 CD2 CD2 mAb 1038h-8-31 (BD Pharmingen # 553637;PMID: 9589560) mAb 1038H-537 (FC) PMID: 23178404) mAb MAC80 (Accurate # YSRTMCA1155;PMID: 7531904) mAb MAC83 (FC, N) Accurate #YSRTMCA1156;BioRad Serotec Serotec # MCA1156;PMID: 9589560) mAb MSA4 (WSU # PG2007;PMID: 9589560) mAb PGBL23A (WSU # PG2008;PMID: 9589560) mAb PG168A (WSU # PG2009;PMID: 9589560) mAb RPA-2.10 (IHC, FC) BioLegend # 300211, Thermo Fisher # 11-0029-42) mAb PGBL6AZ (FC)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products