ADCK2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ADCK2 antibody is: synthetic peptide directed towards the middle region of Human ADCK2. Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 68 kDa |
| Gene Name | aarF domain containing kinase 2 |
| Database Link | |
| Background | The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr) |
| Synonyms | AARF |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Categories | Enzyme: Kinases, Intracellular Proteins, Membrane Proteins |
| Protein Families | Druggable Genome, Protein Kinase |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
ADCK1 is a potential therapeutic target of osteosarcoma
Zhuo, Zhu, Yao et al
Cell Death Dis (2022) 13 (11), 954 DOI: 10.1038/s41419-022-05401-8
Zhuo, Zhu, Yao et al
Cell Death Dis (2022) 13 (11), 954 DOI: 10.1038/s41419-022-05401-8
Cited by 19
AI Summary: OriGene products, specifically ADCK1 shRNA (Cat# TG316386) and ADCK1 CRISPR/Cas9 KO plasmid (Cat# KN316386), were used in this study to silence or knockout ADCK1 expression in osteosarcoma cells, enabling the researchers to demonstrate ADCK1's critical role in promoting tumor cell growth and survival.
Snippet: al rate is only about 20% [2, 7]. In order to develop novel therapeutics to improve patients’ prognosis [8, 9], it is extremely important to further explore the key genes for the progression and tumorigenesis of OS [10–12]. ADCK1 (AarF domain-containing kinase 1) belongs to the mitochondrial ADCK family kinases and localizes at the inner membrane of mitochondria [13]. In Drosophila ADCK1 was
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
