OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TTLL3 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA343263
Rabbit Polyclonal Anti-TTLL3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY422461 Transient overexpression lysate of tubulin tyrosine ligase-like family, member 3 (TTLL3) (as WB positive control) 100 ug
$665.00

View other "TTLL3 or NM_001025930" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TTLL3 antibody is: synthetic peptide directed towards the C-terminal region of TTLL3. Synthetic peptide located within the following region: APVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 48 kDa
Gene Name tubulin tyrosine ligase like 3
Database Link
Background TTLL3 is a monoglycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. It is involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. It is not involved in elongation step of the polyglycylation reaction.
Synonyms HOTTL
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products