TARS2 Rabbit Polyclonal Antibody

CAT#: TA343261

Rabbit Polyclonal Anti-TARS2 Antibody

Product Images

Host: Rabbit; Target Name: TARS2; Sample Tissue: HepG2 whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human TARS2. Synthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: threonyl-tRNA synthetase 2, mitochondrial (putative)
• Database Link:
  NP_079426
  Entrez Gene 80222 Human
  UniProt ID Q9BW92
• Background: The function of this protein remains unknown.
• Synonyms: COXPD21; TARSL1; thrRS
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Pig: 93%; Bovine: 86%; Dog: 85%; Rat: 79%

Reference Data

• Protein Pathways: Aminoacyl-tRNA biosynthesis