SLAMF1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Slamf1 antibody is: synthetic peptide directed towards the middle region of Mouse Slamf1. Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 38 kDa |
| Gene Name | signaling lymphocytic activation molecule family member 1 |
| Database Link | |
| Background | Slamf1 is a high-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates. |
| Synonyms | CD150; CDw150; SLAM |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 93%; Mouse: 87%; Dog: 85%; Horse: 85%; Rabbit: 80%; Guinea pig: 80%; Goat; Sheep; Bovine |
| Reference Data | |
| Protein Categories | CD Markers, Cytokines, Membrane Proteins, Secreated Proteins |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.