MPPED2 Rabbit Polyclonal Antibody

SKU TA343232

Rabbit Polyclonal Anti-MPPED2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mpped2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mpped2. Synthetic peptide located within the following region: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: metallophosphoesterase domain containing 2
• Database Link:
  NP_001575
  Q15777
• Background: Human homolog is expressed in brain and maps to an area of the chromosome associated with WAGR syndrome; It may be involved in brain development.
• Synonyms: 239FB; C11orf8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data