ELL3 Rabbit Polyclonal Antibody

CAT#: TA343230

Rabbit Polyclonal Anti-ELL3 Antibody

Product Images

Host: Rabbit; Target Name: Ell3; Sample Tissue: Mouse Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ell3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ell3. Synthetic peptide located within the following region: PEHKVLEDKIVQEYKKFRKRYPSYREEKHRCEYLHQKLSHIKGLILEFEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: elongation factor for RNA polymerase II 3
• Database Link:
  NP_079441
  Entrez Gene 269344 Mouse
  UniProt ID Q9HB65
• Background: Ell3 is an elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA.
• Synonyms: FLJ22637
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Pig: 79%

Reference Data

• Protein Families: Transcription Factors