DPEP2 Rabbit Polyclonal Antibody

SKU TA343219

Rabbit Polyclonal Anti-DPEP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPEP2 antibody is: synthetic peptide directed towards the C-terminal region of Human DPEP2. Synthetic peptide located within the following region: VFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQEL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: dipeptidase 2
• Database Link:
  NP_071750
  Q9H4A9
• Background: DPEP2 belongs to the membrane-bound dipeptidase (EC 3.4.13.19) family. These enzymes hydrolyze a variety of dipeptides, including leukotriene D4, the beta-lactam ring of some antibiotics, and cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation.
• Synonyms: MBD2
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Protease