GIT1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Rat |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Git1 antibody is: synthetic peptide directed towards the middle region of Rat Git1. Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 84 kDa |
| Gene Name | GIT ArfGAP 1 |
| Database Link | |
| Background | Git1 mediates beta2-adrenergic receptor endocytosis. |
| Synonyms | G protein-coupled receptor kinase-interactor 1; G protein-coupled receptor kinase interacting ArfGAP 1; G protein-coupled receptor kinase interactor 1; OTTHUMP00000163606 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75% |
| Reference Data | |
| Protein Categories | Cytokines, Intracellular Proteins |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Regulation of actin cytoskeleton |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.