DHH Rabbit Polyclonal Antibody

CAT#: TA343152

Rabbit Polyclonal Anti-DHH Antibody

Product Images

Host: Rabbit; Target Name: Dhh; Sample Tissue: Mouse Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: desert hedgehog
• Database Link:
  NP_066382
  Entrez Gene 13363 Mouse
  UniProt ID O43323
• Background: Dhh is an intercellular signal essential for a variety of patterning events during development. It may function as a spermatocyte survival factor in the testes and it is essential for testes development.
• Synonyms: GDXYM; HHG-3; SRXY7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Rabbit: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protease
• Protein Pathways: Hedgehog signaling pathway