DHH Rabbit Polyclonal Antibody

CAT#: TA343152

Rabbit Polyclonal Anti-DHH Antibody

 Product Datasheet for 'TA343152'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 43kDa
Gene Name desert hedgehog
Background Dhh is an intercellular signal essential for a variety of patterning events during development. It may function as a spermatocyte survival factor in the testes and it is essential for testes development.
Synonyms GDXYM|HHG-3|SRXY7
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Rabbit: 93%; Zebrafish: 93%
Reference Data
Protein Families ES Cell Differentiation/IPS, Protease, Druggable Genome
Protein Pathways Hedgehog signaling pathway
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones