EIF4B Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Eif4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eif4b. Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 41 kDa |
| Gene Name | eukaryotic translation initiation factor 4B |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | EIF-4B; PRO1843 |
| Note | Immunogen Sequence Homology: Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Pathways | mTOR signaling pathway |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.