Syntaxin 7 (STX7) Rabbit Polyclonal Antibody

CAT#: TA343113

Rabbit Polyclonal Anti-STX7 Antibody

Product Images

WB Suggested Anti-STX7 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell STX7 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: syntaxin 7
• Database Link:
  NP_003560
  Entrez Gene 8417 Human
  UniProt ID O15400
• Background: STX7 may be involved in protein trafficking from the plasma membrane to the early endosome (EE) as well as in homotypic fusion of endocytic organelles. STX7 mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes.
• Synonyms: OTTHUMP00000017219; OTTHUMP00000017221; syntaxin 7
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport