HEXA Rabbit Polyclonal Antibody

CAT#: TA343107

Rabbit Polyclonal Anti-HEXA Antibody

Product Images

WB Suggested Anti-HEXA Antibody Titration: 1 ug/ml; Positive Control: Fetal kidney lysate

• 

  Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5 ug/ml using anti-HEXA antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: hexosaminidase subunit alpha
• Database Link:
  NP_000511
  Entrez Gene 3073 Human
  UniProt ID P06865
• Background: This gene encodes the alpha subunit of the lysosomal enzyme beta-hexosaminidase that, together with the cofactor GM2 activator protein, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Beta-hexosaminidase is composed of two subunits, alpha and beta, which are encoded by separate genes. Both beta-hexosaminidase alpha and beta subunits are members of family 20 of glycosyl hydrolases. Mutations in the alpha or beta subunit genes lead to an accumulation of GM2 ganglioside in neurons and neurodegenerative disorders termed the GM2 gangliosidoses. Alpha subunit gene mutations lead to Tay-Sachs disease (GM2-gangliosidosis type I).
• Synonyms: TSD
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%; Dog: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Glycosaminoglycan degradation, Glycosphingolipid biosynthesis - ganglio series, Glycosphingolipid biosynthesis - globo series, Lysosome, Metabolic pathways, Other glycan degradation