SF3B5 Rabbit Polyclonal Antibody

SKU TA343080

Rabbit Polyclonal Anti-SF3B5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sf3b5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sf3b5. Synthetic peptide located within the following region: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 10 kDa
• Gene Name: splicing factor 3b subunit 5
• Database Link:
  NP_112577
  Q9BWJ5
• Background: The function of this protein remains unknown.
• Synonyms: SF3b10; Ysf3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 92%

Reference Data

• Protein Pathways: Spliceosome