CEACAM7 Rabbit Polyclonal Antibody

CAT#: TA342851

Rabbit Polyclonal Anti-CEACAM7 Antibody

Product Images

WB Suggested Anti-CEACAM7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CEACAM7 antibody: synthetic peptide directed towards the C terminal of human CEACAM7. Synthetic peptide located within the following region: FSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: carcinoembryonic antigen related cell adhesion molecule 7
• Database Link:
  NP_008821
  Entrez Gene 1087 Human
  UniProt ID Q14002
• Background: The function of CEACAM7 remains unknow.
• Synonyms: CGM2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 79%; Rabbit: 75%