IGSF8 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-IGSF8 antibody: synthetic peptide directed towards the middle region of human IGSF8. Synthetic peptide located within the following region: LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 65 kDa |
| Gene Name | immunoglobulin superfamily member 8 |
| Database Link | |
| Background | IGSF8 may play a key role in diverse functions ascribed to CD81 and CD9 such as oocytes fertilization or hepatitis C virus function. IGSF8 may regulate proliferation and differentiation of keratinocytes. IGSF8 may be a negative regulator of cell motility: suppresses T-cell mobility coordinately with CD81, associates with CD82 to suppress prostate cancer cell migration, regulates epidermoid cell reaggregation and motility on laminin-5 with CD9 and CD81 as key linkers. IGSF8 may also play a role on integrin-dependent morphology and motility functions. IGSF8 may participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain. |
| Synonyms | CD81P3; CD316; EWI-2; EWI2; KCT-4; LIR-D1; PGRL |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 83%; Dog: 79% |
| Reference Data | |
| Protein Categories | CD Markers, Intracellular Proteins, Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.