PLEKHG2 Rabbit Polyclonal Antibody

CAT#: TA342682

Rabbit Polyclonal Anti-PLEKHG2 Antibody


 Product Datasheet for 'TA342682'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PLEKHG2 antibody: synthetic peptide directed towards the middle region of human PLEKHG2. Synthetic peptide located within the following region: DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 144 kDa
Gene Name pleckstrin homology and RhoGEF domain containing G2
Background PLEKHG2 may be a transforming oncogene with exchange activity for CDC42. PLEKHG2 may be a guanine-nucleotide exchange factor (GEF) for RAC1 and CDC42.PLEKHG2 activated by the binding to subunits beta and gamma of the heterotrimeric guanine nucleotide-binding protein (G protein).
Synonyms ARHGEF42; CLG; LDAMD
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data
Other products for "PLEKHG2"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones