OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USP8 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342558
Rabbit Polyclonal Anti-USP8 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY417494 Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP316926 Recombinant protein of human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 20 µg
20 ug
$867.00

View other "USP8 or NM_005154" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 127 kDa
Gene Name ubiquitin specific peptidase 8
Database Link
Background USP8 is a hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. USP8 converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. USP8 catalytic activity is enhanced in the M phase. USP8 is involved in cell proliferation. USP8 is required to enter into S phase in response to serum stimulation. USP8 may regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. USP8 probably regulates the stability of STAM2 and RASGRF1. USP8 regulates endosomal ubiquitin dynamics, cargo sorting, membrane traffic at early endosomes, and maintenance of ESCRT-0 stability. The level of protein ubiquitination on endosomes is essential for maintaining the morphology of the organelle.USP8 deubiquitinates EPS15 and controles tyrosine kinase stability.USP8 removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK signaling. USP8 is involved in acrosome biogenesis through interaction with the spermatid ESCRT-0 complex and microtubules.
Synonyms HumORF8; SPG59; UBPY
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data
Protein Categories Cytokines, Endocrine and metabolic diseases, Enzyme: Peptidases, Growth Factors, Intracellular Proteins
Protein Families Druggable Genome, Protease
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products