MAML3 Rabbit Polyclonal Antibody

SKU TA342460

Rabbit Polyclonal Anti-MAML3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAML3 antibody: synthetic peptide directed towards the middle region of human MAML3. Synthetic peptide located within the following region: YPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGPSQNPG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 122 kDa
• Gene Name: mastermind like transcriptional coactivator 3
• Database Link:
  NP_061187
  Q96JK9
• Background: MAML3 acts as a transcriptional coactivator for NOTCH proteins. MAML3 has been shown to amplify NOTCH-induced transcription of HES1.
• Synonyms: CAGH3; ERDA3; GDN; MAM-2; MAM2; TNRC3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Notch signaling pathway