LRRN3 Rabbit Polyclonal Antibody

CAT#: TA342368

Rabbit Polyclonal Anti-LRRN3 Antibody

Product Images

WB Suggested Anti-LRRN3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRRN3 antibody: synthetic peptide directed towards the N terminal of human LRRN3. Synthetic peptide located within the following region: ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: leucine rich repeat neuronal 3
• Database Link:
  NP_001093130
  Entrez Gene 54674 Human
  UniProt ID Q9H3W5
• Background: LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.
• Synonyms: FIGLER5; NLRR-3; NLRR3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane