Irf5 Rabbit Polyclonal Antibody

CAT#: TA342305

Rabbit Polyclonal Anti-IRF5 Antibody

Product Images

WB Suggested Anti-IRF5 Antibody Titration: 0.15 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Lymphnode

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the N terminal of mouse IRF5. Synthetic peptide located within the following region: CSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: interferon regulatory factor 5
• Database Link:
  NP_036187
  Entrez Gene 3663 Human
  UniProt ID P56477
• Background: Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling.
• Synonyms: IBD14; IRF-5; SLEB10
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%