The immunogen for anti-Msx3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Msx3. Synthetic peptide located within the following region: EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM
Buffer
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
mouse homolog represses transcription of Msx1; repression may be mediated by binding to cAMP-response element binding protein CBP and histone deacetylase 1 RGD, Feb 2006. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SRS369732 ECO:0000348 ##Evidence-Data-END##
Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Price:
Actual Price:
Redirect notification
You will be redirected to our european store (OriGene Technologies GmbH) based on your location
