Msx3 Rabbit Polyclonal Antibody

SKU
TA342281
Rabbit Polyclonal Anti-Msx3 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Msx3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Msx3. Synthetic peptide located within the following region: EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 22 kDa
Gene Name msh homeobox 3
Database Link
Background mouse homolog represses transcription of Msx1; repression may be mediated by binding to cAMP-response element binding protein CBP and histone deacetylase 1 RGD, Feb 2006. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SRS369732 ECO:0000348 ##Evidence-Data-END##
Synonyms AI323377
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.