Trypsin (PRSS3) Rabbit Polyclonal Antibody

CAT#: TA342157

Reviews ()
Write a review

Rabbit polyclonal Anti-PRSS3 Antibody


Product Datasheet for 'TA342157'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Purification Affinity Purified
Predicted Protein Size 33 kDa
Gene Name protease, serine 3
Background This gene encodes a trypsinogen, which is a member ofThe trypsin family of serine proteases.This enzyme is expressed inThe brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involvingThe carboxyl group of lysine or arginine.This gene is localized toThe locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2010]
Synonyms MTG; PRSS4; T9; TRY3; TRY4
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Bovine: 91%
Reference Data
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Neuroactive ligand-receptor interaction
Other products for "PRSS3"
Frequently bought together (2)
Transient overexpression lysate of protease, serine, 3 (PRSS3), transcript variant 1
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones