OSGIN1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-OSGIN1 antibody: synthetic peptide directed towards the N terminal of human OSGIN1. Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 61 kDa |
| Gene Name | oxidative stress induced growth inhibitor 1 |
| Database Link | |
| Background | This gene encodes an oxidative stress response protein that regulates cell death. Expression ofThe gene is regulated by p53 and is induced by DNA damage.The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules.The loss ofThis protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists betweenThis gene andThe neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, butThe read-through transcripts are unlikely to produce a protein product. provided by RefSeq, Aug 2011 |
| Synonyms | BDGI; OKL38 |
| Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 79% |
| Reference Data | |
| Protein Categories | Growth Factors, Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
