OriGene Logo

PHF19 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342124
Rabbit Polyclonal Anti-PHF19 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414412 Transient overexpression lysate of PHD finger protein 19 (PHF19), transcript variant 1 100 ug
$665.00

View other "PHF19 or NM_001009936" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PHF19 antibody: synthetic peptide directed towards the C terminal of human PHF19. Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 22 kDa
Gene Name PHD finger protein 19
Database Link
Background PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Synonyms MTF2L1; PCL3; TDRD19B
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.