RHBDL2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-RHBDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human RHBDL2. Synthetic peptide located within the following region: ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 40 kDa |
| Gene Name | rhomboid like 2 |
| Database Link | |
| Background | The protein encoded byThis gene is a member ofThe rhomboid family of integral membrane proteins.This family contains proteins that are related to Drosophila rhomboid protein. Members ofThis family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases.The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. provided by RefSeq, Jul 2008 |
| Synonyms | RRP2 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Categories | Enzyme: Peptidases, Growth Factors, Membrane Proteins |
| Protein Families | Protease, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
