BPNT2 Rabbit Polyclonal Antibody

SKU TA342037

Rabbit Polyclonal Anti-IMPAD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the N terminal of human IMPAD1. Synthetic peptide located within the following region: VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: inositol monophosphatase domain containing 1
• Database Link:
  NP_060283
  Q9NX62
• Background: This gene encodes a member ofThe inositol monophosphatase family.The encoded protein is localized toThe Golgi apparatus and catalyzesThe hydrolysis of phosphoadenosine phosphate (PAP) to adenosine monophosphate (AMP). Mutations inThis gene are a cause of GRAPP type chondrodysplasia with joint dislocations, and a pseudogene ofThis gene is located onThe long arm of chromosome 1. [provided by RefSeq, Dec 2011]
• Synonyms: GPAPP; IMP-3; IMP 3; IMPA3
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane