OriGene Logo

BPNT2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342037
Rabbit Polyclonal Anti-IMPAD1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY413522 Transient overexpression lysate of inositol monophosphatase domain containing 1 (IMPAD1) 100 ug
$436.00

View other "BPNT2 or NM_017813" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the N terminal of human IMPAD1. Synthetic peptide located within the following region: VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name inositol monophosphatase domain containing 1
Database Link
Background This gene encodes a member ofThe inositol monophosphatase family.The encoded protein is localized toThe Golgi apparatus and catalyzesThe hydrolysis of phosphoadenosine phosphate (PAP) to adenosine monophosphate (AMP). Mutations inThis gene are a cause of GRAPP type chondrodysplasia with joint dislocations, and a pseudogene ofThis gene is located onThe long arm of chromosome 1. provided by RefSeq, Dec 2011
Synonyms GPAPP; IMP-3; IMP 3; IMPA3
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 85%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.