TMEM69 Rabbit Polyclonal Antibody

CAT#: TA342015

Rabbit Polyclonal Anti-TMEM69 Antibody

Product Images

WB Suggested Anti-TMEM69 Antibody Titration: 0.5 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM69 antibody: synthetic peptide directed towards the middle region of human TMEM69. Synthetic peptide located within the following region: AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: transmembrane protein 69
• Database Link:
  NP_057570
  Entrez Gene 51249 Human
  UniProt ID Q5SWH9
• Background: The function remains unknown.
• Synonyms: C1orf154
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane