IER3IP1 Rabbit Polyclonal Antibody

SKU TA341995

Rabbit Polyclonal Anti-Hdhd2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Hdhd2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hdhd2. Synthetic peptide located within the following region: LMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: immediate early response 3 interacting protein 1
• Database Link:
  NP_057181
  Q9Y5U9
• Background: The function ofThis protein remains unknown.
• Synonyms: HSPC039; MEDS; PRO2309
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 92%; Yeast: 83%

Reference Data

• Protein Families: Transmembrane