MINAR1 Rabbit Polyclonal Antibody

SKU TA341965

Rabbit Polyclonal Anti-KIAA1024 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA1024 antibody: synthetic peptide directed towards the C terminal of human KIAA1024. Synthetic peptide located within the following region: DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 103 kDa
• Gene Name: KIAA1024
• Database Link:
  NP_056021
  Q9UPX6
• Background: KIAA1024 is a single-pass membrane proteinPotential. It belongs toThe UPF0258 family.The function ofThe KIAA1024 protein remains unknown.
• Synonyms: KIAA1024
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane