OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SV2A Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341964
Rabbit Polyclonal Anti-SV2A Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414979 Transient overexpression lysate of synaptic vesicle glycoprotein 2A (SV2A) (as WB positive control) 100 ug
$436.00

View other "SV2A or NM_014849" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 83 kDa
Gene Name synaptic vesicle glycoprotein 2A
Database Link
Background Plays a role inThe control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintainingThe readily releasable pool of secretory vesicles.
Synonyms SV2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Categories Membrane Proteins
Protein Families Secreted Protein, Transmembrane
Protein Pathways ECM-receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

[EXPRESS] Brivaracetam attenuates pain behaviors in a murine model of neuropathic pain
Tsymbalyuk, Smith, Gore et al
Mol Pain (2019) 15, 1744806919886503 DOI: 10.1177/1744806919886503
AI Summary: OriGene’s rabbit anti-SV2A antibody (cat#TA322365) was used for immunohistochemistry and immunoblot validation to assess SV2A expression in mouse spinal cord tissues in this study.
Snippet: Immunoblot for validation of anti-SV2A antibody To validate the rabbit anti-SV2A antibody used for immunohistochemistry (cat#TA322365;Origene, Rockville, MD, USA), we performed an immunoblot of lysate from mouse brain, from an immortalized rat;intervals. Immunoblot for validation of anti-SV2A antibody. To validate the rabbit anti-SV2A antibody used for immunohistochemistry (cat#TA322365;Origene, Rockville, MD, USA), we Millipore, Temecula, CA, USA);rabbit anti-SV2A (1:50;cat#TA322365;Origene)
WB IHC
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products