WSCD2 Rabbit Polyclonal Antibody

SKU TA341947

Rabbit Polyclonal Anti-WSCD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WSCD2 antibody: synthetic peptide directed towards the C terminal of human WSCD2. Synthetic peptide located within the following region: GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: WSC domain containing 2
• Database Link:
  NP_055468
  Q2TBF2
• Background: The function remains known.
• Synonyms: KIAA0789; MGC117165
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Mouse: 85%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane