BMP10 Rabbit Polyclonal Antibody

CAT#: TA341939

Rabbit Polyclonal Anti-Bmp10 Antibody

Product Images

WB Suggested Anti-Bmp10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Rat Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Bmp10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: bone morphogenetic protein 10
• Database Link:
  NP_055297
  Entrez Gene 500245 Rat
  UniProt ID O95393
• Background: Bmp10 is required for maintainingThe proliferative activity of embryonic cardiomyocytes by preventing premature activation ofThe negative cell cycle regulator CDKN1C/p57KIP and maintainingThe required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Bmp10 acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Bmp10 inhibits endothelial cell migration and growth.
• Synonyms: MGC126783
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane