PCDHA4 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PCDHA4 antibody: synthetic peptide directed towards the C terminal of human PCDHA4. Synthetic peptide located within the following region: SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 99 kDa |
| Gene Name | protocadherin alpha 4 |
| Database Link | |
| Background | This gene is a member ofThe protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.The alpha gene cluster is composed of 15 cadherin superfamily genes related toThe mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes inThe cluster.The large, uninterrupted N-terminal exons each encode six cadherin ectodomains whileThe C-terminal exons encodeThe cytoplasmic domain.These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role inThe establishment and function of specific cell-cell connections inThe brain. Alternative splicing has been observed and additional variants have been suggested butTheir full-length nature has yet to be determined. provided by RefSeq, Jul 2008 |
| Synonyms | CNR1; CNRN1; CRNR1; PCDH-ALPHA4 |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
