ST6GALNAC6 Rabbit Polyclonal Antibody

CAT#: TA341921

Rabbit Polyclonal Anti-ST6GALNAC6 Antibody

Product Images

WB Suggested Anti-ST6GALNAC6 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6. Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
• Database Link:
  NP_038471
  Entrez Gene 30815 Human
  UniProt ID Q969X2
• Background: ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides onThe cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (5) differs inThe 5' UTR, lacks a portion ofThe 5' coding region, and initiates translation from a downstream in-frame start codon, compared to variant 1.The encoded isoform (c) is shorter atThe N-terminus, compared to isoform a. Variants 3, 4 and 5 all encode isoform c. ##Evidence-Data-START## Transcript exon combination :: AK057100.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: SIAT7-F; SIAT7F; ST6GALNACVI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways