The immunogen for anti-PILRB antibody: synthetic peptide directed towards the middle region of human PILRB. Synthetic peptide located within the following region: KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA
Buffer
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
The paired immunoglobin-like type 2 receptors consist of highly related activating and inhibitory receptors that are involved inThe regulation of many aspects ofThe immune system.The paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7.This gene encodesThe activating member ofThe receptor pair and contains a truncated cytoplasmic tail relative to its inhibitory counterpart (PILRA), that has a long cytoplasmic tail with immunoreceptor tyrosine-based inhibitory (ITIM) motifs.This gene is thought to have arisen from a duplication ofThe inhibitory PILRA gene and evolved to acquire its activating function. provided by RefSeq, Jun 2013
Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Price:
Actual Price:
Redirect notification
You will be redirected to our european store (OriGene Technologies GmbH) based on your location
