TSPAN15 Rabbit Polyclonal Antibody

CAT#: TA341909

Rabbit Polyclonal Anti-TSPAN15 Antibody

Product Images

WB Suggested Anti-TSPAN15 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSPAN15 antibody: synthetic peptide directed towards the C terminal of human TSPAN15. Synthetic peptide located within the following region: LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: tetraspanin 15
• Database Link:
  NP_036471
  Entrez Gene 23555 Human
  UniProt ID O95858
• Background: The protein encoded byThis gene is a member ofThe transmembrane 4 superfamily, also known asThe tetraspanin family. Most ofThese members are cell-surface proteins that are characterized byThe presence of four hydrophobic domains.The proteins mediate signal transduction events that play a role inThe regulation of cell development, activation, growth and motility.The use of alternate polyadenylation sites has been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: 2700063A19Rik; NET-7; NET7; TM4SF15
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%

Reference Data

• Protein Families: Transmembrane